skills/database-lookup/references/ncbi-protein.md
Protein sequence records (RefSeq, GenBank, UniProt imports) accessible via NCBI E-utilities with db=protein.
https://eutils.ncbi.nlm.nih.gov/entrez/eutils/
&api_key=YOUR_KEY.tool and email parameters for identification.GET esearch.fcgi?db=protein&term=QUERY&retmax=N&retmode=json
| Param | Description |
|---|---|
term | Search query (Entrez syntax). Fields: [Protein Name], [Organism], [Accession], [Gene Name] |
retmax | Max IDs returned (default 20, max 100000) |
retstart | Offset for pagination |
usehistory | y to store results on server (use with large sets) |
Example -- search human insulin:
GET esearch.fcgi?db=protein&term=insulin+AND+homo+sapiens[Organism]&retmax=5&retmode=json
Response (JSON):
{
"esearchresult": {
"count": "1523",
"retmax": "5",
"idlist": ["116734704", "AAA59172.1", "NP_000198.1", ...],
"querytranslation": "insulin AND \"Homo sapiens\"[Organism]"
}
}
GET efetch.fcgi?db=protein&id=IDS&rettype=TYPE&retmode=MODE
| rettype | retmode | Output |
|---|---|---|
fasta | text | FASTA sequence |
gp | text | GenPept flat file |
gp | xml | GenPept XML (INSDSeq) |
acc | text | Accession list |
seqid | text | SeqID list |
ft | text | Feature table |
Example -- fetch FASTA for NP_000198.1 (human insulin):
GET efetch.fcgi?db=protein&id=NP_000198.1&rettype=fasta&retmode=text
Response:
>NP_000198.1 insulin preproprotein [Homo sapiens]
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
Example -- fetch GenPept XML for multiple IDs:
GET efetch.fcgi?db=protein&id=NP_000198.1,NP_001278826.1&rettype=gp&retmode=xml
GET esummary.fcgi?db=protein&id=IDS&retmode=json
Returns: accession, title, organism, length, taxonomy, create/update dates.
GET elink.fcgi?dbfrom=protein&db=gene&id=NP_000198.1
Links protein to gene, nucleotide, structure, taxonomy, etc.
# By accession
term=NP_000198.1[Accession]
# By gene name + organism
term=BRCA1[Gene Name] AND human[Organism]
# RefSeq only
term=insulin AND srcdb_refseq[Properties]
# By sequence length range
term=100:500[Sequence Length] AND kinase[Protein Name]
usehistory=y with WebEnv/query_key, then fetch in chunks of 500